AHSP_MOUSE   Q9CY02


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CY02

Recommended name:Alpha-hemoglobin-stabilizing protein

EC number:

Alternative names:(Erythroid differentiation-related factor) (Erythroid-associated factor)

Cleaved into:

GeneID:170812

Gene names  (primary ):Ahsp

Gene names  (synonym ):Edrf Eraf

Gene names  (ORF ):

Length:102

Mass:11832

Sequence:MAPFQSNKDLISTGIKEFNVLLDQQVFDDPLISEEDMVIVVHDWVNLYTNYYKKLVHGEQEEQDRAMTEFQQELSTLGSQFLAKYRTFLKSKEPPSNTLPSS

Tissue specificity:Expressed in spleen, bone marrow, and blood, with highest levels in bone marrow. {ECO:0000269|PubMed:11231637, ECO:0000269|PubMed:12066189}.

Induction:By GATA-1 during erythroid maturation.

Developmental stage:

Protein families:AHSP family


   💬 WhatsApp