FAM3B_MOUSE Q9D309
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D309
Recommended name：Protein FAM3B
EC number：
Alternative names：(Cytokine-like protein 2-21) (Pancreatic-derived factor) (PANDER)
Cleaved into：
GeneID：52793
Gene names (primary )：Fam3b
Gene names (synonym )：ORF9
Gene names (ORF )：
Length：235
Mass：26152
Sequence：MRPVATGIFKALVFIFSSLCAWYSGYLLAELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR
Tissue specificity：Expressed at high levels in the pancreas and, to a lesser extent, in small intestine and prostate. Also detected in stomach, testis and fetal liver. In the pancreas, localized in the islets of Langerhans; in the testis, found primarily in the round spermatids; in the CNS, found in the Purkinje cell layer of the cerebellum and in nerve cell bodies of numerous brainstem nuclei.
Induction：By glucose. {ECO:0000269|PubMed:17962352}.
Developmental stage：
Protein families：FAM3 family