EGR1_MOUSE P08046
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P08046
Recommended name:Early growth response protein 1
EC number:
Alternative names:(EGR-1) (Nerve growth factor-induced protein A) (NGFI-A) (Transcription factor Zif268) (Zinc finger protein Krox-24)
Cleaved into:
GeneID:13653
Gene names (primary ):Egr1
Gene names (synonym ):Egr-1 Krox-24
Gene names (ORF ):
Length:533
Mass:56590
Sequence:MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGTPEGSGGNSSSSTSSGGGGGGGSNSGSSAFNPQGEPSEQPYEHLTTESFSDIALNNEKAMVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPTSSSSAPSPAASSSSSASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPATKGGFQVPMIPDYLFPQQQGDLSLGTPDQKPFQGLENRTQQPSLTPLSTIKAFATQSGSQDLKALNTTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVASPAASSLSSYPSPVATSYPSPATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQVSSFPSAGVSSSFSTSTGLSDMTATFSPRTIEIC
Tissue specificity:Detected in lung vasculature and in mononuclear phagocytes (PubMed:11100120). Detected in liver (at protein level) (PubMed:15265859). Detected in lung vasculature and in mononuclear phagocytes (PubMed:11100120). Expressed in the liver in a circadian manner (PubMed:26471974). {ECO:0000269|PubMed:11100120, ECO:0000269|PubMed:15265859, ECO:0000269|PubMed:26471974}.
Induction:By growth factors (PubMed:3133658). Up-regulated in lung vasculature in response to reperfusion after ischemia (PubMed:11100120). Up-regulated in liver in response to partial hepatectomy (PubMed:15265859). {ECO:0000269|PubMed:11100120, ECO:0000269|PubMed:15265859, ECO:0000269|PubMed:3133658}.
Developmental stage:
Protein families:EGR C2H2-type zinc-finger protein family