TAGL_MOUSE P37804
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P37804
Recommended name：Transgelin
EC number：
Alternative names：(Actin-associated protein p27) (Smooth muscle protein 22-alpha) (SM22-alpha)
Cleaved into：
GeneID：21345
Gene names (primary )：Tagln
Gene names (synonym )：Sm22 Sm22a
Gene names (ORF )：
Length：201
Mass：22576
Sequence：MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIVVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPEGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLYEGKDMAAVQRTLMALGSLAVTKNDGNYRGDPNWFMKKAQEHKRDFTDSQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Tissue specificity：
Induction：By growth factors.
Developmental stage：
Protein families：Calponin family