PNKD_MOUSE Q69ZP3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q69ZP3
Recommended name：Probable hydrolase PNKD
EC number：EC 3.-.-.-
Alternative names：(Myofibrillogenesis regulator 1) (MR-1) (Paroxysmal nonkinesiogenic dyskinesia protein)
Cleaved into：
GeneID：56695
Gene names (primary )：Pnkd
Gene names (synonym )：Brp17 Kiaa1184 Mr1 Tahccp2
Gene names (ORF )：Fksg19 MNCb-5687
Length：385
Mass：43017
Sequence：MAAVVAATALKGRGARNARVLRGILSGATANKASQNRTRALQSHSSPECKEEPEPLSPELEYIPRKRGKNPMKAVGLAWYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLFNGVKVLPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLELQEALGPGPGPTSDDGCSRAQLLEELRRLKDMHKSK
Tissue specificity：Expressed in many discrete areas of the brain. {ECO:0000269|PubMed:15496428}.
Induction：By Hepatitis C virus core protein. {ECO:0000269|PubMed:15188498}.
Developmental stage：
Protein families：Metallo-beta-lactamase superfamily, Glyoxalase II family