PDCL3_MOUSE Q8BVF2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BVF2
Recommended name:Phosducin-like protein 3
EC number:
Alternative names:(Viral IAP-associated factor 1) (VIAF-1)
Cleaved into:
GeneID:68833
Gene names (primary ):Pdcl3
Gene names (synonym ):Viaf1
Gene names (ORF ):
Length:240
Mass:27581
Sequence:MQDPNADTEWNDILRKKGILPPKESLKELEEEEAEKEEQLLQQSVVKTYEDMTLEELEENEDEFSEEDERAIEMYRQQRLAEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCSLINHHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTVFVYREGDIKAQFIGPLVFGGMNLTIDELEWKLSESGAIKTALEENPKKPIQDLLLSSVRGPVPMRRDSDSEDD
Tissue specificity:Expressed in blood vessels (at protein level). {ECO:0000269|PubMed:26059764}.
Induction:By hypoxia and heat shock. {ECO:0000269|PubMed:26059764, ECO:0000269|PubMed:27496612}.
Developmental stage:
Protein families:Phosducin family