PKRI1_MOUSE   Q9CWV6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CWV6

Recommended name:PRKR-interacting protein 1

EC number:

Alternative names:(Protein C114)

Cleaved into:

GeneID:66801

Gene names  (primary ):Prkrip1

Gene names  (synonym ):

Gene names  (ORF ):

Length:186

Mass:21492

Sequence:MASPAAASVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMNEWAPRAPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLDAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQKEEPSQCQEQHASSSDEASETEEEEEEPSVVIMGR

Tissue specificity:Broadly expressed, with highest levels in liver, kidney, brain and heart. {ECO:0000269|PubMed:12679338}.

Induction:By IL11. {ECO:0000269|PubMed:12679338}.

Developmental stage:

Protein families:PRKRIP1 family


   💬 WhatsApp