TNR4_MOUSE P47741
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P47741
Recommended name：Tumor necrosis factor receptor superfamily member 4
EC number：
Alternative names：(OX40 antigen) (OX40L receptor) (CD antigen CD134)
Cleaved into：
GeneID：22163
Gene names (primary )：Tnfrsf4
Gene names (synonym )：Ox40 Txgp1
Gene names (ORF )：
Length：272
Mass：30154
Sequence：MYVWVQQPTALLLLALTLGVTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPAFAVLLGLGLGLLAPLTVLLALYLLRKAWRLPNTPKPCWGNSFRTPIQEEHTDAHFTLAKI
Tissue specificity：Expressed in CD4(+) T-cells and in T-helper Th17 cells (at protein level). {ECO:0000269|PubMed:29244194}.
Induction：By IL6/STAT3 signaling in T-helper Th17 cells. {ECO:0000269|PubMed:29244194}.
Developmental stage：
Protein families：