CXL15_MOUSE Q9WVL7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WVL7
Recommended name：C-X-C motif chemokine 15
EC number：
Alternative names：(Lungkine) (Small-inducible cytokine B15)
Cleaved into：
GeneID：20309
Gene names (primary )：Cxcl15
Gene names (synonym )：Scyb15
Gene names (ORF )：
Length：167
Mass：19091
Sequence：MAAQGWSMLLLAVLNLGIFVRPCDTQELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA
Tissue specificity：Expression restricted to the lung, produced by bronchoepithelial cells and is released into the airways. Expressed at low levels in fetal lung. {ECO:0000269|PubMed:10228029, ECO:0000269|PubMed:11207292}.
Induction：By inflammation; in lung. {ECO:0000269|PubMed:10228029}.
Developmental stage：
Protein families：Intercrine alpha (chemokine CxC) family