PSME1_MOUSE   P97371


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97371

Recommended name:Proteasome activator complex subunit 1

EC number:

Alternative names:(11S regulator complex subunit alpha) (REG-alpha) (Activator of multicatalytic protease subunit 1) (Proteasome activator 28 subunit alpha) (PA28a) (PA28alpha)

Cleaved into:

GeneID:19186

Gene names  (primary ):Psme1

Gene names  (synonym ):

Gene names  (ORF ):

Length:249

Mass:28673

Sequence:MATLRVHPEAQAKVDVFREDLCSKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEEKEEKKKGDEDDKGPPCGPVNCNEKIVVLLQRLKPEIKDVTEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTNLHTKLEGFHTQISKYFSERGDAVAKAAKQPHVGDYRQLVHELDEAEYQEIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

Tissue specificity:

Induction:By interferon gamma.

Developmental stage:

Protein families:PA28 family


   💬 WhatsApp