IRF8_MOUSE P23611
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P23611
Recommended name：Interferon regulatory factor 8
EC number：
Alternative names：(IRF-8) (Interferon consensus sequence-binding protein) (ICSBP)
Cleaved into：
GeneID：15900
Gene names (primary )：Irf8
Gene names (synonym )：Icsbp Icsbp1
Gene names (ORF )：
Length：424
Mass：48237
Sequence：MCDRNGGRRLRQWLIEQIDSSMYPGLIWENDEKTMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVAPAGCMSEVPEMECGRSEIEELIKEPSVDEYMGMTKRSPSPPEACRSQILPDWWVQQPSAGLPLVTGYAAYDTHHSAFSQMVISFYYGGKLVGQATTTCLEGCRLSLSQPGLPKLYGPDGLEPVCFPTADTIPSERQRQVTRKLFGHLERGVLLHSNRKGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTNQFIRELQQFYATQSRLPDSRVVLCFGEEFPDTVPLRSKLILVQVEQLYARQLVEEAGKSCGAGSLMPALEEPQPDQAFRMFPDICTSHQRPFFRENQQITV
Tissue specificity：Mainly expressed in lymphoid tissues (PubMed:2111015). Predominantly expressed in CD8(+)-expressing dendritic cells (PubMed:12393690). {ECO:0000269|PubMed:12393690, ECO:0000269|PubMed:2111015}.
Induction：By interferon gamma. {ECO:0000269|PubMed:17579016}.
Developmental stage：
Protein families：IRF family