LY6E_MOUSE Q64253
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64253
Recommended name:Lymphocyte antigen 6E
EC number:
Alternative names:(Ly-6E) (Stem cell antigen 2) (Thymic shared antigen 1) (TSA-1)
Cleaved into:
GeneID:17069
Gene names (primary ):Ly6e
Gene names (synonym ):Ly67 Sca-2 Tsa-1
Gene names (ORF ):
Length:136
Mass:14392
Sequence:MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP
Tissue specificity:Ubiquitously expressed in mouse adult tissues with maximal expression in the lung and the salivary gland. Expression is strikingly lower in the fetal tissues except for the placenta (PubMed:28679758). Present in thymus where its expression is observed in immature thymocytes and thymic stromal cells (PubMed:1531995). Also found on functionally active T-cells as well as B-cells and thymic dendritic cells (PubMed:2987354). {ECO:0000269|PubMed:1531995, ECO:0000269|PubMed:28679758, ECO:0000269|PubMed:2987354}.
Induction:By interferon gamma/IFN-gamma on resting T-cells. {ECO:0000269|PubMed:3040423}.
Developmental stage:
Protein families: