RTP4_MOUSE Q9ER80
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ER80
Recommended name：Receptor-transporting protein 4
EC number：
Alternative names：(28 kDa interferon-responsive protein)
Cleaved into：
GeneID：67775
Gene names (primary )：Rtp4
Gene names (synonym )：Ifrg28
Gene names (ORF )：
Length：249
Mass：28392
Sequence：MLFPDDFSTWEQTFQELMQEEKPGAKWSLHLDKNIVPDGAALGWRQHQQTVLGRFQCSRCCRSWTSAQVMILCHMYPDTLKSQGQARMRIFGQKCQKCFGCQFETPKFSTEIIKRILNNLVNYILQRYYGHRKIALTSNASLGEKVTLDGPHDTRNCEACSLNSHGRCALAHKVKPPRSPSPLPKSSSPSKSCPPPPQTRNTDFGNKTFQDFGNRTFQGCREPPQREIEPPLFLFLSIAAFALFSLFTR
Tissue specificity：Expressed at low levels in olfactory neurons. {ECO:0000269|PubMed:15550249}.
Induction：By interferons.
Developmental stage：
Protein families：TMEM7 family