WF15B_MOUSE Q9JHY4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JHY4
Recommended name：WAP four-disulfide core domain protein 15B
EC number：
Alternative names：(Elafin-like protein I) (Single WAP motif protein 1)
Cleaved into：
GeneID：192201
Gene names (primary )：Wfdc15b
Gene names (synonym )：Swam1 Wfdc15
Gene names (ORF )：
Length：80
Mass：9237
Sequence：MKLLGLSLLAVTILLCCNMARPEIKKKNVFSKPGYCPEYRVPCPFVLIPKCRRDKGCKDALKCCFFYCQMRCVDPWESPE
Tissue specificity：Constitutively expressed in kidney and epididymis. {ECO:0000269|PubMed:12574366}.
Induction：By intranasal administration of S.pneumoniae. {ECO:0000269|PubMed:12574366}.
Developmental stage：
Protein families：