TAFA3_MOUSE Q7TPG6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TPG6
Recommended name：Chemokine-like protein TAFA-3
EC number：
Alternative names：
Cleaved into：
GeneID：329731
Gene names (primary )：Tafa3
Gene names (synonym )：Fam19a3
Gene names (ORF )：
Length：132
Mass：14426
Sequence：MERPTSNWSAGSWVLALCLAWLWTCPASASLQPPTSAVLVKQGTCEVIAAHRCCNRNRIEERSQTVKCSCLSGQVAGTTRAKPSCVDASIVLQKWWCQMEPCLLGEECKVLPDLSGWSCSSGHKVKTTKVTR
Tissue specificity：Highly expressed in brain, in regions such as the hippocampus, the habenular, thalamic nuclei and hypophysial pars tuberalis (PubMed:25595455). Expression levels in the hypophysial pars tuberalis vary between day and night: they are low at mid-day and high at mid-night. The expression in the other regions do not display a day/night difference (PubMed:22426341). {ECO:0000269|PubMed:22426341, ECO:0000269|PubMed:25595455}.
Induction：By ischemia. Up-regulated in the microglia in the middle cerebral artery occlusion (MCAO), expression reduced back to control level at 14 days after MCAO. {ECO:0000269|PubMed:25595455}.
Developmental stage：
Protein families：TAFA family