BKRB1_MOUSE Q61125
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61125
Recommended name：B1 bradykinin receptor
EC number：
Alternative names：(B1R) (BK-1 receptor)
Cleaved into：
GeneID：12061
Gene names (primary )：Bdkrb1
Gene names (synonym )：Bdkrb
Gene names (ORF )：
Length：334
Mass：37886
Sequence：MASQASLKLQPSNQSQQAPPNITSCEGAPEAWDLLCRVLPGFVITVCFFGLLGNLLVLSFFLLPWRRWWQQRRQRLTIAEIYLANLAASDLVFVLGLPFWAENVGNRFNWPFGSDLCRVVSGVIKANLFISIFLVVAISQDRYRLLVYPMTSWGNRRRRQAQVTCLLIWVAGGLLSTPTFLLRSVKVVPDLNISACILLFPHEAWHFVRMVELNVLGFLLPLAAILYFNFHILASLRGQKEASRTRCGGPKDSKTMGLILTLVASFLVCWAPYHFFAFLDFLVQVRVIQDCFWKELTDLGLQLANFFAFVNSCLNPLIYVFAGRLFKTRVLGTL
Tissue specificity：Expressed in heart, liver and lung.
Induction：By lipopolysaccharide (LPS) in heart, liver and lung five hours after treatment. {ECO:0000269|PubMed:8602848}.
Developmental stage：
Protein families：G-protein coupled receptor 1 family, Bradykinin receptor subfamily, BDKRB1 sub-subfamily