FCGR4_MOUSE A0A0B4J1G0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A0A0B4J1G0
Recommended name:Low affinity immunoglobulin gamma Fc region receptor IV
EC number:
Alternative names:(CD16-2) (FcgammaRIV)
Cleaved into:
GeneID:246256
Gene names (primary ):Fcgr4
Gene names (synonym ):
Gene names (ORF ):
Length:249
Mass:28398
Sequence:MWQLLLPTALVLTAFSGIQAGLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQITFCLLIGLLFAIDTVLYFSVRRGLQSPVADYEEPKIQWSKEPQDK
Tissue specificity:Detected on myeloid cells, peripheral blood monocytes, splenic and bone marrow dendritic cells, and thioglycollate-elicited macrophages and neutrophils but absent from lymphoid populations with no expression observed on T cells, B cells, NK cells or other granulocytes (at protein level) (PubMed:16039578, PubMed:19795417). Expressed in peripheral blood leukocytes, spleen, liver, thymus and small intestine (PubMed:12389094, PubMed:17558411). {ECO:0000269|PubMed:12389094, ECO:0000269|PubMed:16039578, ECO:0000269|PubMed:17558411, ECO:0000269|PubMed:19795417}.
Induction:By lipopolysaccharide, interferon beta and IFNG. {ECO:0000269|PubMed:17558411}.
Developmental stage:
Protein families: