IL27A_MOUSE Q8K3I6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K3I6
Recommended name:Interleukin-27 subunit alpha
EC number:
Alternative names:(IL-27 subunit alpha) (IL-27-A) (IL27-A) (p28)
Cleaved into:
GeneID:246779
Gene names (primary ):Il27
Gene names (synonym ):Il27a
Gene names (ORF ):
Length:234
Mass:26542
Sequence:MGQVTGDLGWRLSLLLLPLLLVQAGSWGFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS
Tissue specificity:Expressed in macrophages and dendritic cells. {ECO:0000269|PubMed:12121660}.
Induction:By LPS and Interferon gamma in primary astrocytes and microglia. Induced by Toll-like receptor ligand in dendritic cells. Inhibited by PPAR-alpha agonist such as fenofibrate and produced by TNF-alpha in microglia. {ECO:0000269|PubMed:15804443, ECO:0000269|PubMed:16906166, ECO:0000269|PubMed:17548596, ECO:0000269|PubMed:17709543, ECO:0000269|PubMed:17727629}.
Developmental stage:
Protein families:IL-6 superfamily