I22R1_MOUSE Q80XZ4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80XZ4
Recommended name：Interleukin-22 receptor subunit alpha-1
EC number：
Alternative names：(IL-22 receptor subunit alpha-1) (IL-22R-alpha-1) (IL-22RA1)
Cleaved into：
GeneID：230828
Gene names (primary )：Il22ra1
Gene names (synonym )：
Gene names (ORF )：
Length：581
Mass：63795
Sequence：MKTLLTILTVGSLAAHTTVDTSGLLQHVKFQSSNFENILTWDGGPASTSDTVYSVEYKKYGERKWLAKAGCQRITQKFCNLTMETRNHTEFYYAKVTAVSAGGPPVTKMTDRFSSLQHTTIKPPDVTCIPKVRSIQMLVHPTLTPVLSEDGHQLTLEEIFHDLFYRLELHVNHTYQMHLEGKQREYEFLGLTPDTEFLGSITILTPILSKESAPYVCRVKTLPDRTWAYSFSGAVLFSMGFLVGLLCYLGYKYITKPPVPPNSLNVQRVLTFQPLRFIQEHVLIPVLDLSGPSSLPQPIQYSQVVVSGPREPPGAVWRQSLSDLTYVGQSDVSILQPTNVPAQQTLSPPSYAPKAVPEVQPPSYAPQVASDAKALFYSPQQGMKTRPATYDPQDILDSCPASYAVCVEDSGKDSTPGILSTPKYLKTKGQLQEDTLVRSCLPGDLSLQKVTSLGEGETQRPKSLPSPLGFCTDRGPDLHTLRSEEPETPRYLKGALSLLSSVQIEGHPVSLPLHVHSVSCSPSDEGPSPWGLLDSLVCPKDEGPAVETEAMCPSAAASELEQSTELDSLFKGLALTVQWES
Tissue specificity：Expressed in kidney, liver and lung. {ECO:0000269|PubMed:12618864}.
Induction：By LPS stimulation in the liver. {ECO:0000269|PubMed:12618864}.
Developmental stage：
Protein families：Type II cytokine receptor family