RIPP2_MOUSE Q2WG76
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q2WG76
Recommended name：Protein ripply2
EC number：
Alternative names：
Cleaved into：
GeneID：382089
Gene names (primary )：Ripply2
Gene names (synonym )：
Gene names (ORF )：
Length：128
Mass：14305
Sequence：MDTTESAESAHNPARPPSRSRCPPSAQPGSEGFWRPWVRTPGEKEKRTGPRAAEALPSGPGMAEASGKLLQYQHPVRLFWPKSKCYDYLYQEAETLLKNFPIQATISFYEDSDSEDEIEGLACENQSN
Tissue specificity：Expressed in the embryonic anterior presomitic mesoderm. First expressed in S-I at E8.5, where expression is maintained until E13.5, with an additional stripe of expression sometimes seen in the rostral part of S0 and S-I. {ECO:0000269|PubMed:16326386, ECO:0000269|PubMed:17531978}.
Induction：By MESP2, and acts in a negative feedback loop with MESP2, functioning negatively toward MESP2 to regulate NOTCH signaling in the anterior presomitic mesoderm. {ECO:0000269|PubMed:17360776}.
Developmental stage：
Protein families：Ripply family