PRAF3_MOUSE Q8R5J9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R5J9
Recommended name:PRA1 family protein 3
EC number:
Alternative names:(ADP-ribosylation factor-like protein 6-interacting protein 5) (ARL-6-interacting protein 5) (Aip-5) (Addicsin) (GTRAP3-18) (Glutamate transporter EAAC1-interacting protein) (Prenylated Rab acceptor protein 2) (Protein JWa)
Cleaved into:
GeneID:65106
Gene names (primary ):Arl6ip5
Gene names (synonym ):Aip5 Jwa Pra2 Praf3
Gene names (ORF ):
Length:188
Mass:21558
Sequence:MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGFLSPFNMILGGVIVVLVFMGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISMFGGVMVFVFGITLPLLLMFIHASLRLRNLKNKLENKMEGIGLKKTPMGIILDALEQQEDNINKFADYISKARE
Tissue specificity:Expressed in the cerebral cortex, cerebellum, hippocampus, olfactory bulbs, medulla oblongate and limbic system (at protein level) (PubMed:18684713). Ubiquitous. {ECO:0000269|PubMed:12119102, ECO:0000269|PubMed:12438930, ECO:0000269|PubMed:18684713}.
Induction:By methyl-beta-cyclodextrin. Up-regulated upon chronic morphine injection, in amygdala only, other brain regions remain unaffected. Induction by morphine may affect glutamate uptake in the amygdala, causing mice to develop morphine tolerance and dependence (PubMed:12438930). Was originally reported to be induced by retinoic acid (PubMed:12562531). {ECO:0000269|PubMed:12438930, ECO:0000305|PubMed:12562531}.
Developmental stage:
Protein families:PRA1 family