BTG2_MOUSE   Q04211


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q04211

Recommended name:Protein BTG2

EC number:

Alternative names:(BTG family member 2) (NGF-inducible protein TIS21)

Cleaved into:

GeneID:12227

Gene names  (primary ):Btg2

Gene names  (synonym ):Tis21

Gene names  (ORF ):

Length:158

Mass:17682

Sequence:MSHGKRTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSRALQDALTDHYKHHWFPEKPSKGSGYRCIRINHKMDPIISKVASQIGLSQPQLHRLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPVAASYGLLTCKNQMMLGRSSPSKNYVMAVSS

Tissue specificity:

Induction:By nerve growth factor and tumors promoters. {ECO:0000269|PubMed:1713584}.

Developmental stage:

Protein families:BTG family


   💬 WhatsApp