SIVA_MOUSE O54926
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O54926
Recommended name：Apoptosis regulatory protein Siva
EC number：
Alternative names：(CD27-binding protein) (CD27BP)
Cleaved into：
GeneID：30954
Gene names (primary )：Siva1
Gene names (synonym )：Siva
Gene names (ORF )：
Length：175
Mass：18770
Sequence：MPKRSCPFADAAPLQLKVHVGLKELSHGVFAERYSREVFERTKQLLFQGARAYRDHISSEDCSVNHLQESLKSGVVGAPQPARGQMLIGPDGRLTRCQAQASEGGLPRTAPIACSSCMRSVDGKAVCSQCERALCGQCVYTCWGCGALACVLCGLADYADDGEKTLCTSCAMFEA
Tissue specificity：Highly expressed in testis, heart, liver, lung, and muscle, and less in kidney, spleen and brain.
Induction：By p53, camptothecin, stroke injury and infection with coxsackievirus B3. This up-regulation is sufficient to induce apoptosis in neural tissue. {ECO:0000269|PubMed:10756043, ECO:0000269|PubMed:15105421}.
Developmental stage：
Protein families：