CP4AE_MOUSE O35728
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35728
Recommended name：Cytochrome P450 4A14
EC number：
Alternative names：(CYPIVA14) (Lauric acid hydroxylase)
Cleaved into：
GeneID：13119
Gene names (primary )：Cyp4a14
Gene names (synonym )：
Gene names (ORF )：
Length：507
Mass：58720
Sequence：MGFFLFSPTRYLDGISGFFQWAFLLSLFLVLFKAVQFYLRRQWLLKTLQHFPCMPSHWLWGHHLKDKELQQILIWVEKFPSACLQCLSGSNIRVLLYDPDYVKVVLGRSDPKASGIYQFFAPWIGYGLLLLNGKKWFQHRRMLTPAFHYDILKPYVKIMADSVNIMLDKWEKLDGQDHPLEIFHCVSLMTLDTVMKCAFSYQGSVQLDENSKLYTKAVEDLNNLTFFRLRNAFYKYNIIYNMSSDGRLSHHACQIAHEHTDGVIKMRKSQLQNEEELQKARKKRHLDFLDILLFARMEDRNSLSDEDLRAEVDTFMFEGHDTTASGISWIFYALATHPEHQQRCREEVQSILGDGTSVTWDHLGQMPYTTMCIKEALRLYPPVISVSRELSSPVTFPDGRSIPKGITATISIYGLHHNPRFWPNPKVFDPSRFAPDSSHHSHAYLPFSGGSRNCIGKQFAMNELKVAVALTLLRFELLPDPTRIPVPIARLVLKSKNGIHLCLKKLR
Tissue specificity：Gender- and strain-specific expression in kidney (at protein level). Predominantly expressed in females, the expression among strains decreasing in the following order: FVB/N > NMRI > Balb/c > 129 Sv/J > C57BL/6 (PubMed:17112342). Expressed at very low level in liver, kidney and spleen of both male and female C57BL/6 X CBA hybrid mice (PubMed:9271096). {ECO:0000269|PubMed:17112342, ECO:0000269|PubMed:9271096}.
Induction：By peroxisome proliferator methylclofenapate; 1000-fold in liver, 10-fold in kidney. {ECO:0000269|PubMed:9271096}.
Developmental stage：
Protein families：Cytochrome P450 family