IBP7_MOUSE Q61581
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61581
Recommended name：Insulin-like growth factor-binding protein 7
EC number：
Alternative names：(IBP-7) (IGF-binding protein 7) (IGFBP-7) (MAC25 protein)
Cleaved into：
GeneID：29817
Gene names (primary )：Igfbp7
Gene names (synonym )：Mac25
Gene names (ORF )：
Length：281
Mass：28969
Sequence：MERPPRALLLGAAGLLLLLLPLSSSSSSDACGPCVPASCPALPRLGCPLGETRDACGCCPVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVCGSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGAQL
Tissue specificity：Expressed at high levels in lung, kidney, small intestine, testis and uterus and at moderate levels in liver. {ECO:0000269|PubMed:10623583}.
Induction：By retinoic acid.
Developmental stage：
Protein families：