CENPX_MOUSE Q8C4X1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C4X1
Recommended name：Centromere protein X
EC number：
Alternative names：(CENP-X) (FANCM-interacting histone fold protein 2) (Fanconi anemia-associated polypeptide of 10 kDa) (Immediate-early-response protein D9) (Retinoic acid-inducible gene D9 protein) (Stimulated by retinoic acid gene 13 protein homolog)
Cleaved into：
GeneID：20892
Gene names (primary )：Cenpx
Gene names (synonym )：Faap10 Mhf2 Stra13
Gene names (ORF )：
Length：78
Mass：8926
Sequence：MEGNSGFRKELVSRLLHLHFRDCKTKVSGDALQLMAEFLRIFVLEAAVRGVWQAQAEDLDVVEVDQLEKVLPQLLLDF
Tissue specificity：
Induction：By retinoic acid. {ECO:0000269|PubMed:8839844}.
Developmental stage：
Protein families：CENP-X/MHF2 family