ELOV6_MOUSE Q920L5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q920L5
Recommended name：Elongation of very long chain fatty acids protein 6
EC number：EC 2.3.1.199
Alternative names：(3-keto acyl-CoA synthase Elovl6) (ELOVL fatty acid elongase 6) (ELOVL FA elongase 6) (Fatty acyl-CoA elongase) (Long chain fatty acid elongase) (Myelin-associated SUR4 protein) (Very long chain 3-ketoacyl-CoA synthase 6) (Very long chain 3-oxoacyl-CoA synthase 6)
Cleaved into：
GeneID：170439
Gene names (primary )：Elovl6
Gene names (synonym )：Face Lce Masr
Gene names (ORF )：
Length：267
Mass：31610
Sequence：MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE
Tissue specificity：Highly expressed in adrenal gland, liver, white adipose tissue (WAT), adult and fetal brain, cerebellum, spinal cord, testis, skin and peripheral nerve; where lipogenesis and steroidogenesis are active. Weakly expressed in kidney, heart, skeletal muscle, lung, and spleen. {ECO:0000269|PubMed:11567032, ECO:0000269|PubMed:12032166, ECO:0000269|PubMed:12084938}.
Induction：By SREBF1. {ECO:0000269|PubMed:11567032, ECO:0000269|PubMed:12032166}.
Developmental stage：
Protein families：ELO family, ELOVL6 subfamily