ARGI1_MOUSE Q61176
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61176
Recommended name：Arginase-1
EC number：EC 3.5.3.1
Alternative names：(Liver-type arginase) (Type I arginase)
Cleaved into：
GeneID：11846
Gene names (primary )：Arg1
Gene names (synonym )：
Gene names (ORF )：
Length：323
Mass：34808
Sequence：MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK
Tissue specificity：Expressed in macrophages (PubMed:7537672, PubMed:12193690, PubMed:19360123). Expressed in precursor and mature group 2 innate lymphoid cells (ILC2s) (PubMed:27043409). Expressed in lung tumor-associated myeloid cells (PubMed:15313928). Expressed in lung tumor-infiltrating dendritic cells (PubMed:19414774). {ECO:0000269|PubMed:12193690, ECO:0000269|PubMed:19360123, ECO:0000269|PubMed:19414774, ECO:0000269|PubMed:27043409, ECO:0000269|PubMed:7537672}.
Induction：By T helper 2 (Th2) cytokines such as IL-4, IL-13 and IL-10. In tumor-infiltrating dendritic cells by prostaglandin E2. {ECO:0000269|PubMed:12193690, ECO:0000269|PubMed:19414774, ECO:0000269|PubMed:7537672}.
Developmental stage：
Protein families：Arginase family