KLF11_MOUSE Q8K1S5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K1S5
Recommended name：Krueppel-like factor 11
EC number：
Alternative names：(TGFB-inducible early growth response protein 2b) (Transforming growth factor-beta-inducible early growth response protein 3) (TGFB-inducible early growth response protein 3) (TIEG-3)
Cleaved into：
GeneID：194655
Gene names (primary )：Klf11
Gene names (synonym )：Tieg2b Tieg3
Gene names (ORF )：
Length：502
Mass：54054
Sequence：MHSPGSTGPGDGRAADIMDICESILERKRHDSERSTCSVLEQTDIEAVEALVCMSSWGQRSQMRPLTPVSDSGDVTTAVLMDTAAPDLPKDFHSFSTLCITPPQSPELTEPSTGTPVPSQVVNSKGCMVTALPPSPAGGPRTLSKREPLEPASGSSCRAVMTSVIRHTGESPAPTRFPTGPTQEQRASDSGEGQERLLDHLEALQDTRLANGLLVTNLVSCQPCLHKSGGSFPTDKGQQTGWPAAVQTCLPKNPESDLSRKITPLISVPVSSPPVLCQMIPVAGQNGLFSAFLKPPTQLPAGTIKPILPQAASMSQPVFMGPPVPQGTVMLVLPQNTFPQPAACPSSVMAIGNTKLLPLAPAPVFLASSQNCAPQVDFSRRRNYVCNFPGCRKTYFKSSHLKAHLRTHTGEKPFTCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRITLAESPGSILEPLPASG
Tissue specificity：
Induction：By TGF-beta. Expressed in a circadian manner in the kidney and epididymal fat tissue. {ECO:0000269|PubMed:14697507, ECO:0000269|PubMed:20385766}.
Developmental stage：
Protein families：Sp1 C2H2-type zinc-finger protein family