CLC5A_MOUSE Q9R007
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R007
Recommended name:C-type lectin domain family 5 member A
EC number:
Alternative names:(C-type lectin superfamily member 5) (Myeloid DAP12-associating lectin 1) (MDL-1)
Cleaved into:
GeneID:23845
Gene names (primary ):Clec5a
Gene names (synonym ):Clecsf5 Mdl1
Gene names (ORF ):
Length:190
Mass:21696
Sequence:MNWHMIISGLIVVVIKVVGMTFFLLYFPQVFGKSNDGFVPTESYGTTSVQNVSQIFGRNDESTMPTRSYGTVCPRNWDFHQGKCFFFSFSESPWKDSMDYCATQGSTLAIVNTPEKLKYLQDIAGIENYFIGLVRQPGEKKWRWINNSVFNGNVTNQDQNFDCVTIGLTKTYDAASCEVSYRWICEMNAK
Tissue specificity:Strong expression in bone marrow cells and thioglycollate-induced neutrophils (at protein level) (PubMed:19074552). Expressed on granulocytes and monocytes from bone marrow and peripheral blood (PubMed:20212065). Expressed in macrophage cell line J-774, but not in T-cell lines, B-cell lines, or mast cell lines (PubMed:10449773). {ECO:0000269|PubMed:10449773, ECO:0000269|PubMed:19074552, ECO:0000269|PubMed:20212065}.
Induction:By TNF in bone-marrow derived macrophage colony-stimulating factor-dependent macrophages (PubMed:20212065). Up-regulated during the differentiation of myeloid cell line 32Dcl3 into neutrophils (PubMed:19074552). {ECO:0000269|PubMed:19074552, ECO:0000269|PubMed:20212065}.
Developmental stage:
Protein families: