TWST1_MOUSE   P26687


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P26687

Recommended name:Twist-related protein 1

EC number:

Alternative names:(M-twist)

Cleaved into:

GeneID:22160

Gene names  (primary ):Twist1

Gene names  (synonym ):Twist

Gene names  (ORF ):

Length:206

Mass:21198

Sequence:MMQDVSSSPVSPADDSLSNSEEEPDRQQPASGKRGARKRRSSRRSAGGSAGPGGATGGGIGGGDEPGSPAQGKRGKKSAGGGGGGGAGGGGGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

Tissue specificity:Subset of mesodermal cells. {ECO:0000269|PubMed:1840517}.

Induction:By TNF-alpha. {ECO:0000269|PubMed:12553906}.

Developmental stage:

Protein families:


   💬 WhatsApp