SDF2L_MOUSE   Q9ESP1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9ESP1

Recommended name:Stromal cell-derived factor 2-like protein 1

EC number:

Alternative names:(SDF2-like protein 1)

Cleaved into:

GeneID:64136

Gene names  (primary ):Sdf2l1

Gene names  (synonym ):

Gene names  (ORF ):

Length:221

Mass:23648

Sequence:MWGASRGRVAGPTLLGLLLALSVRSGGASKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL

Tissue specificity:Ubiquitously expressed with high expression in the testis, ovary, uterus, and low expression in heart and skeletal muscle.

Induction:By tunicamycin and a calcium ionophore, A23187.

Developmental stage:

Protein families:


   💬 WhatsApp