IFIT2_MOUSE Q64112
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64112
Recommended name:Interferon-induced protein with tetratricopeptide repeats 2
EC number:
Alternative names:(IFIT-2) (Glucocorticoid-attenuated response gene 39 protein) (GARG-39) (Interferon-induced 54 kDa protein) (IFI-54K) (P54)
Cleaved into:
GeneID:15958
Gene names (primary ):Ifit2
Gene names (synonym ):Garg39 Ifi54 Isg54
Gene names (ORF ):
Length:472
Mass:55021
Sequence:MSTTSKESLVCNLRQLKCHFTWNLIAEDESLDEFEDRVFNKDEFQNSEFKATMCNILAYVKHCRGLNEAALQCLGEAEGFIQQQHPDQVEIRSLVTWGNYAWVYYHMGQFSKAQAYLDKVKQVCKKFSSPYRIENPALDCEEGWARLKCTKNQNERVKVCFQKALEKDPKNPEFTSGWAIAFYRLDDWPARNYCIDSLEQAIQLSPDNTYVKVLLALKLDAVHVHKNQAMALVEEALKKDPSAIDTLLRAARFYCKVYDTDRAIQLLRKALEKLPNNAYVHYYMGCCYRSKVHHMLNRREMVFSGDRKKLEELIQLAVNHLRKAEEIKEMLEYSCSFLADLYIIAKKYDEADYYFQKELSKDLPPGPKQLLHLRYGNFQFFQMKRQDKAIYHYMEGVKIKKKTIPQKKMREKLQRIALRRLHEDESDSEALHILAFLQENGGGQQADKDSERGVDSANQVPSASLDEDGAEY
Tissue specificity:
Induction:By type I interferons, dsRNAs and viruses. {ECO:0000269|PubMed:16023166}.
Developmental stage:
Protein families:IFIT family