STAR4_MOUSE Q99JV5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99JV5
Recommended name：StAR-related lipid transfer protein 4
EC number：
Alternative names：(START domain-containing protein 4) (StARD4)
Cleaved into：
GeneID：170459
Gene names (primary )：Stard4
Gene names (synonym )：
Gene names (ORF )：
Length：224
Mass：25579
Sequence：MADPESPWSQIGRKIKLEGLSDVASISTKLQNTLIQYHSIKEDEWRVAKKVKDVTVWRKPSEEFNGYLYKAQGVMDDVVNNVIDHIRPGPWRLDWDRLMTSLDVLEHFEENCCVMRYTTAGQLLNIISPREFVDFSYTVGYEEGLLSCGVSVEWSETRPEFVRGYNHPCGWFCVPLKDSPSQSLLTGYIQTDLRGMIPQSAVDTAMASTLANFYSDLRKGLRKA
Tissue specificity：Expressed in most tissues, with highest levels in liver and in kidney. {ECO:0000269|PubMed:12011452}.
Induction：Down-regulated by dietary cholesterol. {ECO:0000269|PubMed:12011452}.
Developmental stage：
Protein families：