STAR4_MOUSE   Q99JV5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99JV5

Recommended name:StAR-related lipid transfer protein 4

EC number:

Alternative names:(START domain-containing protein 4) (StARD4)

Cleaved into:

GeneID:170459

Gene names  (primary ):Stard4

Gene names  (synonym ):

Gene names  (ORF ):

Length:224

Mass:25579

Sequence:MADPESPWSQIGRKIKLEGLSDVASISTKLQNTLIQYHSIKEDEWRVAKKVKDVTVWRKPSEEFNGYLYKAQGVMDDVVNNVIDHIRPGPWRLDWDRLMTSLDVLEHFEENCCVMRYTTAGQLLNIISPREFVDFSYTVGYEEGLLSCGVSVEWSETRPEFVRGYNHPCGWFCVPLKDSPSQSLLTGYIQTDLRGMIPQSAVDTAMASTLANFYSDLRKGLRKA

Tissue specificity:Expressed in most tissues, with highest levels in liver and in kidney. {ECO:0000269|PubMed:12011452}.

Induction:Down-regulated by dietary cholesterol. {ECO:0000269|PubMed:12011452}.

Developmental stage:

Protein families:


   💬 WhatsApp