MEDAG_MOUSE Q14BA6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q14BA6
Recommended name：Mesenteric estrogen-dependent adipogenesis protein
EC number：
Alternative names：(Activated in W/Wv mouse stomach 3) (mAWMS3) (Mesenteric estrogen-dependent adipose 4) (MEDA-4)
Cleaved into：
GeneID：70717
Gene names (primary )：Medag
Gene names (synonym )：Awms3 Meda4
Gene names (ORF )：
Length：303
Mass：34364
Sequence：MATAACEPVARPSLTSISSGELRSLWTCDCELALLPLSQLLRLQPGAFQLRGEQLLVPGPGEPAAARGGFNVFGDGLVRLEGQLYRLSSYIKRYVELTNYCDYKDYRETILSKPMVFFINVQTKKDISKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESYRLQFDFQEVVKNFFPPGTIVLNGENLSFTYEFKADALFDFFYWFGLSNSTVKVHGKVLNLTSTNPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSRGSIDDVFNCNLSPRSSVTEPLLAEFSFPSLLECEETSSQLI
Tissue specificity：Highly expressed in white adipose tissue compared with other organs with higher expression in mature adipocyte fraction. Significant expression is also detected in the heart, brain, and pancreas. {ECO:0000269|PubMed:22510272}.
Induction：Down-regulated by estrogen treatment. {ECO:0000269|PubMed:22510272}.
Developmental stage：
Protein families：