C1QL4_MOUSE Q4ZJM9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q4ZJM9
Recommended name：Complement C1q-like protein 4
EC number：
Alternative names：(C1q and tumor necrosis factor-related protein 11) (C1q/TNF-related protein 11) (C1qTNF11) (CTRP11)
Cleaved into：
GeneID：239659
Gene names (primary )：C1ql4
Gene names (synonym )：C1qtnf11 Ctrp11
Gene names (ORF )：
Length：238
Mass：24928
Sequence：MVLLLLVAIPLLVHSSRGPTHYEMLGRCRMVCDPHASRGQGPDGAPASVPSLPPGAKGEVGRRGKAGLRGPPGPPGPRGPPGEPGRPGPPGPPGPGPGGAAPPAGYVPRIAFYAGLRRPHEGYEVLRFDDVVTNVGNAYEAASGKFTCPMPGVYFFAYHVLMRGGDGTSMWADLMKNGQVRASAIAQDADQNYDYASNSVILHLDVGDEVFIKLDGGKVHGGNTNKYSTFSGFIIYPD
Tissue specificity：Highly expressed in testis and adipose tissue, brown adipose tissue expressing higher levels than subcutaneous and visceral white adipose tissue. In gonadal fat pad, expressed at lower levels in adipocytes than in the stromal vascular fraction (VSP), which contains preadipocytes, fibroblasts, endothelial cells and occasional immune cells. Expression exhibits sexually dimorphism, with higher levels in females than in males. {ECO:0000269|PubMed:23449976}.
Induction：Down-regulated in fasted animals. {ECO:0000269|PubMed:23449976}.
Developmental stage：
Protein families：