ACER3_MOUSE Q9D099
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D099
Recommended name：Alkaline ceramidase 3
EC number：EC 3.5.1.-
Alternative names：(AlkCDase 3) (Alkaline CDase 3) (Alkaline phytoceramidase) (aPHC)
Cleaved into：
GeneID：66190
Gene names (primary )：Acer3
Gene names (synonym )：Aphc Phca
Gene names (ORF )：
Length：267
Mass：31565
Sequence：MAPAVDRKGYWGPTTSTLDWCEENYVVTLFVAEFWNTVSNLIMIIPPIFGAIQGIRDRLEKRYIAAYLALTVVGMGSWCFHMTLKYEMQLLDELPMIYSCCIFVYCMFECFKTKSSINYHLLFTLFLYSLTVTTIYLKVKEPIFHQVMYGMLVFTLVLRSIYIVTWVYPWLRGLGYTSLTVFLLGFLLWNIDNIFCDSLRNFRKRVPPVLGVTTQFHAWWHILTGLGSYLHILFSLYTRTLYLRYRPKVKFLFGIWPAVMFEPQRKH
Tissue specificity：Up-regulated with age in cerebeLlum and cerebrum. {ECO:0000269|PubMed:26474409}.
Induction：Down-regulated in immune cells and colonic epithelial cells by lipopolysaccharides/LPS. {ECO:0000269|PubMed:26938296}.
Developmental stage：
Protein families：Alkaline ceramidase family