MOG1_MOUSE Q9JIB0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JIB0
Recommended name：Ran guanine nucleotide release factor
EC number：
Alternative names：(RanGNRF) (Ran-binding protein MOG1)
Cleaved into：
GeneID：57785
Gene names (primary )：Rangrf
Gene names (synonym )：Mog1 Rangnrf
Gene names (ORF )：
Length：185
Mass：20413
Sequence：MEPNRNCPLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIIELLELQAHVQGEAAARYHFEDVGRVQGARAVHVLSVQPLCLENLSLRGCCQDAWSLSGKQQVAKENQQVAKDVTLHQALLRLPQYQTDLLLTFNQPPCHSRSLGPENLSCPPWSLSNFEQLVTSLTLHDPNLFGPQ
Tissue specificity：Highgly abundant in cardiac cells. Expressed in testis during prepubertal development. {ECO:0000269|PubMed:18184654}.
Induction：Down-regulated in mice lacking Ovol1. {ECO:0000269|PubMed:15716349}.
Developmental stage：
Protein families：MOG1 family