SPXN_MOUSE D3Z752
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D3Z752
Recommended name：Spexin
EC number：
Alternative names：(NPQ) (Neuropeptide Q) (Spexin hormone)
Cleaved into：Spexin-1; Spexin-2
GeneID：
Gene names (primary )：Spx
Gene names (synonym )：
Gene names (ORF )：
Length：116
Mass：13004
Sequence：MKGPSVLAVTAVVLLLVLSALENSSGAPQRLSEKRNWTPQAMLYLKGAQGRRFLSDQSRRKELADRPPPERRNPDLELLTLPEAAALFLASLEKSQKDEGGNFDKSELLEDRLFNW
Tissue specificity：
Induction：Down-regulated in omental and subcutaneous fat of obese animals. {ECO:0000269|PubMed:24550067}.
Developmental stage：
Protein families：Spexin family