PLK5_MOUSE Q4FZD7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q4FZD7
Recommended name：Inactive serine/threonine-protein kinase PLK5
EC number：
Alternative names：(Polo-like kinase 5) (PLK-5)
Cleaved into：
GeneID：216166
Gene names (primary )：Plk5
Gene names (synonym )：
Gene names (ORF )：
Length：595
Mass：66055
Sequence：MEPRSRRRRSRQLVATFLRDPGSGRVYRRGKLIGKGAFSRCYKLTDMSTSAVFALKVVPRGGAGRLRLRGKVEREIALHSRLRHRNIVAFHAHFADRDHVYMVLEYCSRQSLAHVLKVRRTLTEPEVRYYLRGLVSGLRYLHQQRIVHRDLKPSNFFLNKNMEVKIGDLGLAARVGPAGRCHRVLCGTPNFQAPEVVSRNGHSCKSDIWALGCIMYTVLTGTPPFAAAPLSEMYQNIRDGHYLEPTHLSPSARSLIARLLAPDPAERPSLDHLLQDDFFSQGFTPERLPPHSCHSPPVFAFPPPLGRLFRKVGQLLLTQCRPPCPFTSKEASGPGEEGTEPDHMEAGNEERDPLCTEGRIHLLTLGTPRTGLAGPKGSLALQLEVATRKLFLCLDAGPMAGQDPPGEQRPVLWAPKWVDYSLKYGFGYQLSDGGSGVLFRDGSHMALRPQGGHVSYQPDQGTLWTFTLRDVPSPLRAKLAVLRLFACYMQRRLREEGTVPMPATPASPDISLLSFIADSQAMVMLFSNGTVQVSLKTSQTQLVLSGEDEDLLLTLQEPGGPAVGVSYTLDVLRSHGFTLAVHHHLRHGLHLLQSV
Tissue specificity：Expressed in the cerebellum, eye and brain cortex (at protein level). Expressed in highly differentiated tissues, such as brain, eyes and ovary. Not detectable in proliferating tissues, such as the colon, spleen and placenta.
Induction：Down-regulated in proliferating cells or in serum-stimulated cells or growth factors. Up-regulated in asynchronous cells, or upon serum deprivation or following stress inducible DNA damage treatment. {ECO:0000269|PubMed:20100802, ECO:0000269|PubMed:21245385}.
Developmental stage：
Protein families：Protein kinase superfamily, Ser/Thr protein kinase family, CDC5/Polo subfamily