SFTA2_MOUSE E9PXB6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:E9PXB6
Recommended name：Surfactant-associated protein 2
EC number：
Alternative names：(Surfactant-associated protein G)
Cleaved into：
GeneID：433102
Gene names (primary )：Sfta2
Gene names (synonym )：
Gene names (ORF )：
Length：77
Mass：8502
Sequence：MESLMRLFLLLALLSSSHAGPKVTLQVKLTETFQDKTSQNSSALDMLQKICLLLHLPSGTNVTLLHKGPPHYLTCRA
Tissue specificity：Expressed in lung, and specifically in alveolar type II epithelial cells. {ECO:0000269|PubMed:22768197}.
Induction：Down-regulated in response to LPS (lipopolysaccharide) challenge. {ECO:0000269|PubMed:22768197}.
Developmental stage：
Protein families：