SPAR_MOUSE   A0A1B0GSZ0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A0A1B0GSZ0

Recommended name:Small regulatory polypeptide of amino acid response

EC number:

Alternative names:

Cleaved into:

GeneID:71406

Gene names  (primary ):Spaar

Gene names  (synonym ):Spar

Gene names  (ORF ):

Length:75

Mass:8470

Sequence:METAVIGMVAVLFVITMAITCILCYFSYDSHTQDPERSSRRSFTVATFHQEASLFTGPALQSRPLPRPQNFWTVV

Tissue specificity:Expressed in the skeletal muscle. {ECO:0000269|PubMed:28024296}.

Induction:Down-regulated in skeletal muscle upon acute injury. {ECO:0000269|PubMed:28024296}.

Developmental stage:

Protein families:


   💬 WhatsApp