RTCB_MOUSE Q99LF4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99LF4
Recommended name：RNA-splicing ligase RtcB homolog
EC number：EC 6.5.1.8
Alternative names：(3'-phosphate/5'-hydroxy nucleic acid ligase) (Focal adhesion-associated protein) (FAAP)
Cleaved into：
GeneID：28088
Gene names (primary )：Rtcb
Gene names (synonym )：D10Wsu52e
Gene names (ORF )：
Length：505
Mass：55249
Sequence：MSRNYNDELQFLDKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVGGFLPAMKQIGNVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPNKVSPRAKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKG
Tissue specificity：Ubiquitously expressed. Highly expressed in the epididymis with predominant enrichment in the initial segment. During sexual maturation, it is expressed in the caput epididymides. {ECO:0000269|PubMed:21046479}.
Induction：Down-regulated in the epididymis upon castration. {ECO:0000269|PubMed:21046479}.
Developmental stage：
Protein families：RtcB family