KFA_MOUSE Q8K4H1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K4H1
Recommended name：Kynurenine formamidase
EC number：EC 3.5.1.9
Alternative names：(KFA) (KFase) (Arylformamidase) (N-formylkynurenine formamidase) (FKF)
Cleaved into：
GeneID：71562
Gene names (primary )：Afmid
Gene names (synonym )：
Gene names (ORF )：
Length：305
Mass：34229
Sequence：MAFPSLSAGQNPWRNLSSEELEKQYSPSRWVIHTKPEEVVGNFVQIGSQATQKARATRRNQLDVPYGDGEGEKLDIYFPDEDSKAFPLFLFLHGGYWQSGSKDDSAFMVNPLTAQGIVVVIVAYDIAPKGTLDQMVDQVTRSVVFLQRRYPSNEGIYLCGHSAGAHLAAMVLLARWTKHGVTPNLQGFLLVSGIYDLEPLIATSQNDPLRMTLEDAQRNSPQRHLDVVPAQPVAPACPVLVLVGQHDSPEFHRQSKEFYETLLRVGWKASFQQLRGVDHFDIIENLTREDDVLTQIILKTVFQKL
Tissue specificity：Highly expressed in liver. Expressed in kidney. Weakly or not expressed in other tissues. {ECO:0000269|PubMed:12411446}.
Induction：Down-regulated upon IL2-mediated activation. Transcriptional activation correlates with reduced histone acetylation. {ECO:0000269|PubMed:12411446}.
Developmental stage：
Protein families：Kynurenine formamidase family