TP4A3_MOUSE Q9D658
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D658
Recommended name：Protein tyrosine phosphatase type IVA 3
EC number：EC 3.1.3.48
Alternative names：(Protein-tyrosine phosphatase 4a3) (Protein-tyrosine phosphatase of regenerating liver 3) (PRL-3)
Cleaved into：
GeneID：19245
Gene names (primary )：Ptp4a3
Gene names (synonym )：Prl3
Gene names (ORF )：
Length：173
Mass：19652
Sequence：MARMNRPAPVEVSYRHMRFLITHNPSNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFYNDPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM
Tissue specificity：Present in the small intestine, where it is located in the differentiated epithelial cells of the villus but not in the proliferating crypt cells (at protein level). Expressed in heart and skeletal muscle, and at lower levels in lung, spleen and testis. {ECO:0000269|PubMed:15161639, ECO:0000269|PubMed:9514946}.
Induction：Down-regulated upon skeletal muscle denervation. {ECO:0000269|PubMed:15673457}.
Developmental stage：
Protein families：Protein-tyrosine phosphatase family