HEMH_MOUSE   P22315


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P22315

Recommended name:Ferrochelatase, mitochondrial

EC number:EC 4.99.1.1

Alternative names:(Heme synthase) (Protoheme ferro-lyase)

Cleaved into:

GeneID:14151

Gene names  (primary ):Fech

Gene names  (synonym ):

Gene names  (ORF ):

Length:420

Mass:47130

Sequence:MLSASANMAAALRAAGALLREPLVHGSSRACQPWRCQSGAAVAATTEKVHHAKTTKPQAQPERRKPKTGILMLNMGGPETLGEVQDFLQRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQERRIGGGSPIKMWTSKQGEGMVKLLDELSPATAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNEVGQKPTMKWSTIDRWPTHPLLIQCFADHILKELNHFPEEKRSEVVILFSAHSLPMSVVNRGDPYPQEVGATVHKVMEKLGYPNPYRLVWQSKVGPVPWLGPQTDEAIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAQKCGAENIRRAESLNGNPLFSKALADLVHSHIQSNKLCSTQLSLNCPLCVNPVCRKTKSFFTSQQL

Tissue specificity:Erythroid and hepatic cells.

Induction:During erythroid differentiation.

Developmental stage:

Protein families:Ferrochelatase family


   💬 WhatsApp