XPA_MOUSE Q64267
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64267
Recommended name：DNA repair protein complementing XP-A cells homolog
EC number：
Alternative names：(Xeroderma pigmentosum group A-complementing protein homolog)
Cleaved into：
GeneID：22590
Gene names (primary )：Xpa
Gene names (synonym )：Xpac
Gene names (ORF )：
Length：272
Mass：31398
Sequence：MATAEEKQTSPEPVAADEPAQLPAAVRASVERKRQRALMLRQARLAARPYPAAAATGGVASVKAAPKMIDTKGGFILEEEEEKHEIGNIVHEPGPVMEFDYTICEECGKEFMDSYLMNHFDLPTCDSCRDADDKHKLITKTEAKQEYLLKDCDLEKREPALRFLVKKNPRHSQWGDMKLYLKLQVVKRALEVWGSQEALEDAKEVRQENREKMKQKKFDKKVKELRRAIRSSVWKRETTTHQHKYGPEENLEDDMYRKTCTLCGHELTYEKM
Tissue specificity：
Induction：Exhibits a circadian pattern with zenith at around 5 pm and nadir at around 5 am in liver but not in testis, this oscillation is dependent on the circadian clock and on HERC2 regulation. {ECO:0000269|PubMed:20304803}.
Developmental stage：
Protein families：XPA family