SNAT_MOUSE O88816
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88816
Recommended name：Serotonin N-acetyltransferase
EC number：EC 2.3.1.87
Alternative names：(Serotonin acetylase) (Aralkylamine N-acetyltransferase) (AA-NAT)
Cleaved into：
GeneID：11298
Gene names (primary )：Aanat
Gene names (synonym )：Snat
Gene names (ORF )：
Length：205
Mass：23069
Sequence：MLNINSLKPEALHLPLGTSEFLGCQRRHTLPASEFRCLTPEDATSAFEIEREAFISVSGTCPLYLDEIRHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLTQESLTLHRPGGRTAHLHVLAVHRTFRQQGKGSVLLWRYLHHLGSQPAVRRAVLMCEDALVPFYEKFGFQAVGPCAITVGSLTFTELQCSLRCHAFLRRNSGC
Tissue specificity：Highly expressed in pineal gland at night. Expression in the retina has not been confirmed. Extrapineal expression could be strain-specific. {ECO:0000269|PubMed:9838107}.
Induction：Exhibits night/day variations with a drastically increased expression at night in the pineal gland. {ECO:0000269|PubMed:20308563, ECO:0000269|PubMed:9708862, ECO:0000269|PubMed:9838107}.
Developmental stage：
Protein families：Acetyltransferase family, AANAT subfamily