ID4_MOUSE P41139
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P41139
Recommended name：DNA-binding protein inhibitor ID-4
EC number：
Alternative names：(Inhibitor of DNA binding 4) (Inhibitor of differentiation 4)
Cleaved into：
GeneID：15904
Gene names (primary )：Id4
Gene names (synonym )：Id-4 Idb4
Gene names (ORF )：
Length：161
Mass：16596
Sequence：MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPLHPAGACPVAPPRTPLTALNTDPAGAVNKQGDSILCR
Tissue specificity：
Induction：Expressed in a circadian manner in the suprachiasmatic nucleus (SCN) of the brain with peak levels between CT16 and CT20. {ECO:0000269|PubMed:19217292}.
Developmental stage：
Protein families：