PADC1_MOUSE Q9D9N8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D9N8
Recommended name：Protease-associated domain-containing protein 1
EC number：
Alternative names：(Protease-associated domain-containing protein of 21 kDa)
Cleaved into：
GeneID：73327
Gene names (primary )：Pradc1
Gene names (synonym )：Pap21
Gene names (ORF )：
Length：188
Mass：21085
Sequence：MSRGAAGWCCLVLWLPTCVAAHGLRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW
Tissue specificity：Expressed in metabolically active tissues such as liver, muscle, adipose, and heart and different brain regions like cortex and hypothalamus, expression is acutely regulated by the nutritional state. {ECO:0000269|PubMed:31689374}.
Induction：Expression in metabolically active tissues is significantly suppressed by refeeding. {ECO:0000269|PubMed:31689374}.
Developmental stage：
Protein families：